DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:284 Identity:58/284 - (20%)
Similarity:90/284 - (31%) Gaps:122/284 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FTYNLKIDNVQTHIDAQRPKQRITSMEWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEGRP 149
            :||:    .:|.|:      |::.|.     |..::||...||:.:...        |||.....
  Rat   843 YTYS----TLQMHL------QKLESA-----HNPQQIYFRKDVLCETLS--------GNSCPLVT 884

  Fly   150 IRGV-KISYKE------GNPAVFIESNIHARE----WITSATITYFIDELLVPRNPAVRDIAQNV 203
            |..: :.||.|      ..|.:|:.:.:|..|    |:...|:.|     |:..:|..:.:.:..
  Rat   885 ITAMPESSYYEHICQFRTRPYIFLSARVHPGETNASWVMKGTLEY-----LMSNSPTAQSLREAY 944

  Fly   204 DWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPTGEC--IGTDLNRNFDYLWMLTGAESDPCSQLY 266
            .:.|:|:||.||....:.                .|  .|.||||.    |.             
  Rat   945 IFKIVPMLNPDGVINGNH----------------RCSLSGEDLNRQ----WQ------------- 976

  Fly   267 AGPSPESDPEI---SQLTAYINNSIPEGTIK----IYISLHSYGQYVLSPWGHTALEFPEHYPQM 324
             .|:||..|.|   ..|..|:      ..:|    :|...|          ||:           
  Rat   977 -SPNPELHPTIYHAKGLLQYL------AAVKRLPLVYCDYH----------GHS----------- 1013

  Fly   325 MHVAKGFSDALYRRYGTVFTYGSS 348
                         |...||.||.|
  Rat  1014 -------------RKKNVFMYGCS 1024

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 4/14 (29%)
M14_CP_A-B_like 115..410 CDD:199844 52/254 (20%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865
M14_Nna1 862..1132 CDD:349477 51/250 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.