DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:408 Identity:78/408 - (19%)
Similarity:123/408 - (30%) Gaps:167/408 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLARSVEQVRYDNYKV---------------------------YNVRIDDLE----QFK-----L 41
            |..|.|.|:|.:.|.:                           |...|.:.|    ||.     |
Human   771 GNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPL 835

  Fly    42 LHTQERSLKLSSW---------REARHLGESSDIMLPPEYQKTFESLLTKHNFTYNLKIDNV--- 94
            :::.:.:|....|         ....|...|| :....:..|::.::....||.:.   |:|   
Human   836 MYSVQEALNARPWWIRMGTDICYYKNHFSRSS-VAAGGQKGKSYYTITFTVNFPHK---DDVCYF 896

  Fly    95 -----QTHIDAQRPKQRITSMEWTQFHTLEEIYAWLDVIEDRYPD------IVTPFTIGNSYEGR 148
                 .|:...|...|::.|.     |..::||...||:.:....      .:|.....|.||  
Human   897 AYHYPYTYSTLQMHLQKLESA-----HNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYE-- 954

  Fly   149 PIRGVKISYKEGNPAVFIESNIHARE----WITSATITYFIDELLVPRNPAVRDIAQNVDWYIIP 209
                 .|.:....|.||:.:.:|..|    |:...|:.|     |:..||..:.:.::..:.|:|
Human   955 -----HICHFRNRPYVFLSARVHPGETNASWVMKGTLEY-----LMSNNPTAQSLRESYIFKIVP 1009

  Fly   210 VLNTDGFAYSHEVERLWRKSRLPSDPTGEC--IGTDLNRNFDYLWMLTGAESDPCSQLYAGPSPE 272
            :||.||....:.                .|  .|.||||.    |.              .|||:
Human  1010 MLNPDGVINGNH----------------RCSLSGEDLNRQ----WQ--------------SPSPD 1040

  Fly   273 SDPEI---SQLTAYINNSIPEGTIK----IYISLHSYGQYVLSPWGHTALEFPEHYPQMMHVAKG 330
            ..|.|   ..|..|:      ..:|    :|...|          ||:                 
Human  1041 LHPTIYHAKGLLQYL------AAVKRLPLVYCDYH----------GHS----------------- 1072

  Fly   331 FSDALYRRYGTVFTYGSS 348
                   |...||.||.|
Human  1073 -------RKKNVFMYGCS 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 16/94 (17%)
M14_CP_A-B_like 115..410 CDD:199844 52/253 (21%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 54/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.