DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and CPO

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:366 Identity:128/366 - (34%)
Similarity:196/366 - (53%) Gaps:50/366 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ERSLKLSSWREARHLGESSDIMLPPEYQKTFESLLTKHNFTYNLKIDNVQTHIDAQRPKQRITSM 110
            :|||       |:|..|..|..:.|...:|         ::||:                     
Human    22 DRSL-------AQHRQEIVDKSVSPWSLET---------YSYNI--------------------- 49

  Fly   111 EWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEGRPIRGVKISYKEGNP--AVFIESNIHAR 173
                :|.:.|||.|:..|.::|.::||...:|.:||..|:..:|||...|||  .::::..||||
Human    50 ----YHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAR 110

  Fly   174 EWITSATITYFIDELLVPR--NPAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPT 236
            |||..|...:|:.|:|...  |.::|.:.:|:|:|::||||.||:.|:...:|||||||.|.: .
Human   111 EWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHN-N 174

  Fly   237 GECIGTDLNRNFDYLWMLTGAESDPCSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHS 301
            |.|.||||||||:..|...||..:...|.:.|..|.|:||...:.::|.:.  :..|..::::||
Human   175 GTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESK--KDDILCFLTMHS 237

  Fly   302 YGQYVLSPWGHTALEFPEHYPQMMHVAKGFSDALYRRYGTVFTYGSSATTLYEVSGSGKEWAYAV 366
            |||.:|:|:|:|..:...| |:|:.|.:..::||..:|||.:..||||..||..|||.::||..:
Human   238 YGQLILTPYGYTKNKSSNH-PEMIQVGQKAANALKAKYGTNYRVGSSADILYASSGSSRDWARDI 301

  Fly   367 KNIKIHYTIELRDKGELGFVLPPEDIIPVAREVTEGFVGMI 407
             .|...||.||||.|..|||||...|.|...|..|..:.::
Human   302 -GIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 11/53 (21%)
M14_CP_A-B_like 115..410 CDD:199844 117/297 (39%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 119/325 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80747
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8518
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.