DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and AGBL1

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:292 Identity:64/292 - (21%)
Similarity:92/292 - (31%) Gaps:121/292 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FTYNLKIDNVQTHIDAQRPKQRITSMEWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEGRP 149
            :||..    :.||:|......           .|:|:|...||:..         |:|    |.|
Human   734 YTYTA----LMTHLDILEKSV-----------NLKEVYFRQDVLCQ---------TLG----GNP 770

  Fly   150 IRGVKI-SYKEGN-----------PAVFIESNIHARE----WITSATITYFIDELLVPRNPAVRD 198
            ...|.| :..|.|           |...|.:.:|..|    |:...|:     |.||..:|..|.
Human   771 CPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTL-----EFLVSSDPVARL 830

  Fly   199 IAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPTGEC--IGTDLNRNFDYLWMLTGAESDP 261
            :.:|..:.|||:||.||....:.                .|  .|.||||.    |:        
Human   831 LRENFIFKIIPMLNPDGVINGNH----------------RCSLSGEDLNRQ----WL-------- 867

  Fly   262 CSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHSYG-QYVLSPWGHTALEFPEHYPQMM 325
                  .||....|.|                     .|:.| .|.||..|.:.:.|.:.:    
Human   868 ------SPSAHLQPTI---------------------YHAKGLLYHLSSIGRSPVVFCDFH---- 901

  Fly   326 HVAKGFSDALYRRYGTVFTYGSS-ATTLYEVS 356
                |.|     :...||.||.| ..||::.:
Human   902 ----GHS-----QKKNVFLYGCSIKETLWQAA 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 4/14 (29%)
M14_CP_A-B_like 115..410 CDD:199844 59/262 (23%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865
M14_Nna1 754..1019 CDD:349477 58/257 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.