DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prat2 and YMR084W

DIOPT Version :9

Sequence 1:NP_523949.2 Gene:Prat2 / 38753 FlyBaseID:FBgn0041194 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_013801.1 Gene:YMR084W / 855108 SGDID:S000004689 Length:262 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:55/217 - (25%)
Similarity:93/217 - (42%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGVFAAIACGDYPTQLDIAQMICLGLVALQHRGQESAGIVTSLGKSSKNFSVHKGMGMINNLFND 122
            ||:|.........|:.:|...:..||.||:::..:|:|| :..|...::.:::|..|.|::|..:
Yeast     2 CGIFGYCNFLIEKTRGEIIDTLIEGLQALEYKEYDSSGI-SIQGDELESLNIYKQTGKISSLKEE 65

  Fly   123 EAIRKLKGNL------GIGHTRYSTAAASEVVNCQPFVVHTA--HGALAIAHNGELVNCESLRRE 179
            ..:..|..||      ||.|||.:|.......||.|   |.:  .....:.|||.:.|..:|:..
Yeast    66 IDLYNLNKNLPFISHCGIAHTRRATHGGLRRANCHP---HNSDPSNEFVVVHNGVITNFANLKAL 127

  Fly   180 VLERGVGLSTHSDSELIAQSLCCAPE------DVSEHDGPNWPARIRHFMTLAPL--SYSLVVMH 236
            ::.:|....:.:|:|       |.|:      |.|...|.|....:...:.|..|  ||.|:...
Yeast   128 LMAKGYVFKSDTDTE-------CIPKLYKHIYDTSIELGYNLDFHVLTNLVLKELEGSYGLLCTS 185

  Fly   237 K---DKIYAVRDSYGNRPLCLG 255
            .   |::.|.|.   ..||.:|
Yeast   186 SHFPDEVVAARK---GSPLVIG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prat2NP_523949.2 PurF 57..544 CDD:223112 55/217 (25%)
GPATase_N 58..340 CDD:238367 55/217 (25%)
PRTases_typeI 351..487 CDD:206754
YMR084WNP_013801.1 GlmS 1..>262 CDD:223526 55/217 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.591673 Normalized mean entropy S1178
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.