DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Pou5f2

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001075220.2 Gene:Pou5f2 / 680620 RGDID:1589456 Length:335 Species:Rattus norvegicus


Alignment Length:193 Identity:80/193 - (41%)
Similarity:116/193 - (60%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 EEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLK 275
            |:.:....::|..||:.:|:|:.||::|||||.|:|.::|.|.||||||||||.|||..||.||:
  Rat   112 EDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKLR 176

  Fly   276 PLLQKWLEEAD--STTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLA 338
            |||:.||||.|  :..|. ..::.|..|.||| :|.|.|..:...||:.|.:.|:|:.|:|:.:|
  Rat   177 PLLKMWLEEVDEKNLLGI-CRMEMILQQARKR-RRASRERRIGSNLEKLFLQCPEPTPQQISYIA 239

  Fly   339 DSLQLEKEVVRVWFCNRRQKEKRMTPPNT----LG--GDMMDGMP------PG-HM---HHGG 385
            ..|:|:|::|:|||.||.|.....|..::    :|  |....|.|      || |.   |:||
  Rat   240 GRLRLQKDLVQVWFSNRSQMAGWPTNDSSQRENVGATGAPFPGPPVCFPLAPGLHFDFPHYGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 40/73 (55%)
Homeobox 307..360 CDD:278475 21/52 (40%)
Pou5f2NP_001075220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 119..187 CDD:395105 40/67 (60%)
homeodomain <220..256 CDD:412151 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.