DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and lmx1a

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001020669.1 Gene:lmx1a / 558036 ZFINID:ZDB-GENE-041014-332 Length:366 Species:Danio rerio


Alignment Length:335 Identity:55/335 - (16%)
Similarity:91/335 - (27%) Gaps:150/335 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 EEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEV 347
            :|.:..|...::|.......|.::.||.:....:.|.:..|....||..:...:||....|...|
Zfish   164 DEDNLKTAGESNITGDVEHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRV 228

  Fly   348 VRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSPMGTHSHSHSPPMLSPQ 412
            |:|||.|:|.|.|::.                                                 
Zfish   229 VQVWFQNQRAKMKKLV------------------------------------------------- 244

  Fly   413 NMQSSAVAAHQLAAHXQSEIQESNSAAAASTPASLNSLSQQQQQQQQQQQQQHQQQQQHQQQQHT 477
                                                     ::||||:|....|::::...||||
Zfish   245 -----------------------------------------RRQQQQKQTVCPQEKRESPSQQHT 268

  Fly   478 PNTPSSSAGSSATMTSQVMSPQSPLGSSSAGNQANNNNNNNNNNNSSTNNNNNNNNNEEQVKHHQ 542
                ::|.|:            .|:....||:......|.:.::.|                   
Zfish   269 ----ATSCGA------------LPVELECAGSYPLPQQNLSLDSQS------------------- 298

  Fly   543 QQQQQQQASSIAAAAAAAMYMDPMRYQHPHHPHPHPHQHPHLNPAHHPHLFHTSDQLQHSQQQTV 607
                              :.:||.|........|..|.||:.....:...  .||.|.|     .
Zfish   299 ------------------LKLDPFRQGLTPPQMPGDHMHPYGCDTLYDET--DSDPLCH-----F 338

  Fly   608 GGTSSNSQLS 617
            |...|:|:||
Zfish   339 GDCMSSSELS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 1/2 (50%)
Homeobox 307..360 CDD:278475 17/52 (33%)
lmx1aNP_001020669.1 LIM1_Lmx1a 26..77 CDD:188756
LIM 84..140 CDD:295319
Homeobox 188..241 CDD:278475 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.