DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and POU1F1

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001116229.1 Gene:POU1F1 / 5449 HGNCID:9210 Length:317 Species:Homo sapiens


Alignment Length:282 Identity:117/282 - (41%)
Similarity:158/282 - (56%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MQTHHTHHLPAAAAVASAADTVKQEMSHLSQQTRIQQGMASPHAAWHAPHAGHYAPTGG------ 151
            :..|.|:.:....::.|...|.|...:|.| .|.:.......|.:..:.|.|:...|.|      
Human    37 VSNHATNVMSTVPSILSLIQTPKCLCTHFS-VTTLGNTATGLHYSVPSCHYGNQPSTYGVMAGSL 100

  Fly   152 SPLQYHHAMNGMLH--HPAHAVAAAHHQSVAPLHHTLRGESPQLHIHHHMGGGDRDAISGGEE-- 212
            :|..|....:.:.|  .|.|....|...:.|.....||.:|..:                 ||  
Human   101 TPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLV-----------------EEPI 148

  Fly   213 --DTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLK 275
              |:|...:||.||.:||.||||||:||.:||.||..::|:.||||||||||.|||||||.||||
Human   149 DMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLK 213

  Fly   276 PLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADS 340
            .:|.||||||:. .|:..: :|:.|..||||:||:|.::.|.|||:||.:|.|||:|||..:|:.
Human   214 AILSKWLEEAEQ-VGALYN-EKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEE 276

  Fly   341 LQLEKEVVRVWFCNRRQKEKRM 362
            |.|||||||||||||||:|||:
Human   277 LNLEKEVVRVWFCNRRQREKRV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 49/77 (64%)
Homeobox 307..360 CDD:278475 33/52 (63%)
POU1F1NP_001116229.1 POU 150..224 CDD:197673 48/73 (66%)
Homeobox 243..297 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.