DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Ccdc160

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001029231.1 Gene:Ccdc160 / 434778 MGIID:3588225 Length:323 Species:Mus musculus


Alignment Length:199 Identity:44/199 - (22%)
Similarity:69/199 - (34%) Gaps:51/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ISGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLAL-GTLYGNVFSQTTICRFEALQLSFKN 270
            |:.||:|:           ..::||:.:....|:...|. .:|:.:..::.:..|.|:  .|..|
Mouse    70 IAEGEQDS-----------NLRERRMNVSKNDANTNSAFWDSLHLDDATKESSHRRES--ASAWN 121

  Fly   271 MCKLKPLLQ----KWL-------------EEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVK-- 316
            ..||....|    ||.             ||....:.....|::......|.......|.|||  
Mouse   122 KKKLPAATQVTRKKWTEAMPPKLRLHLLNEELGELSLKCREIERDFENAEKELLNFRKEASVKAV 186

  Fly   317 -------GALE-----QHFHKQPKPSAQEITSLADSLQLEKEVV-RVWFCNRRQKE-----KRMT 363
                   ||.:     |.........|..:.:|.:.||..|||: |:...||..|:     |..|
Mouse   187 NFQEPGTGASKKDRELQALKNDLSEKATNVKNLTEELQQAKEVMYRLSLENRNLKDAVRKLKHQT 251

  Fly   364 PPNT 367
            ..||
Mouse   252 ELNT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 17/91 (19%)
Homeobox 307..360 CDD:278475 18/72 (25%)
Ccdc160NP_001029231.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 4/21 (19%)
Smc <149..>301 CDD:224117 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.