Sequence 1: | NP_001303384.1 | Gene: | vvl / 38752 | FlyBaseID: | FBgn0086680 | Length: | 742 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001029231.1 | Gene: | Ccdc160 / 434778 | MGIID: | 3588225 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 69/199 - (34%) | Gaps: | 51/199 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 ISGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLAL-GTLYGNVFSQTTICRFEALQLSFKN 270
Fly 271 MCKLKPLLQ----KWL-------------EEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVK-- 316
Fly 317 -------GALE-----QHFHKQPKPSAQEITSLADSLQLEKEVV-RVWFCNRRQKE-----KRMT 363
Fly 364 PPNT 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vvl | NP_001303384.1 | POU | 212..286 | CDD:197673 | 17/91 (19%) |
Homeobox | 307..360 | CDD:278475 | 18/72 (25%) | ||
Ccdc160 | NP_001029231.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..81 | 4/21 (19%) | |
Smc | <149..>301 | CDD:224117 | 26/107 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847041 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |