DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Cchcr1

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001002822.2 Gene:Cchcr1 / 406196 RGDID:1302992 Length:869 Species:Rattus norvegicus


Alignment Length:231 Identity:49/231 - (21%)
Similarity:81/231 - (35%) Gaps:73/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 LLQKWLEEADSTT---GSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLA 338
            :|::.|:...||.   |.....|:   ||..|:.| |:|:.|.|||.|        .|:.|:...
  Rat   129 VLERRLDTQRSTVTMWGQDFCGDR---QGLGRRGR-SLELGVSGALSQ--------QAELISRQL 181

  Fly   339 DSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSPMGTHSHS 403
            ..|:|.:|.||.......|::.|                                          
  Rat   182 QELRLLEEEVRTLRETSLQQKMR------------------------------------------ 204

  Fly   404 HSPPMLSPQNMQSSAVAAHQLAAHXQSEIQESNSAAAASTPASLNSLSQQQQQQQQQQQQQHQQQ 468
                 |..|.::..|:|..:.|.  |:|.:...:|.|.:.....| |.:.:|::.::.|..||:|
  Rat   205 -----LESQAVELDALAVAEKAG--QAEAEGLRTALAGAEMVRKN-LEEAKQKELEEIQSLHQEQ 261

  Fly   469 QQHQQQQHTPNTPSSSAGSSATMTSQVMSPQSPLGS 504
            .....|.|.....|        :||:....:..|.|
  Rat   262 LSSLTQAHQKALDS--------LTSKAEDLEKSLNS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 2/8 (25%)
Homeobox 307..360 CDD:278475 16/52 (31%)
Cchcr1NP_001002822.2 HCR 110..853 CDD:284517 49/231 (21%)
DUF342 <305..384 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.