DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and LMX1B

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001167617.1 Gene:LMX1B / 4010 HGNCID:6654 Length:406 Species:Homo sapiens


Alignment Length:255 Identity:55/255 - (21%)
Similarity:80/255 - (31%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 EEADSTTGSPTSIDKIAAQG----------------RKRKKRTSIEVSVKGALEQHFHKQPKPSA 331
            :|:||........|...|:|                |.::.||.:....:.|.:..|....||..
Human   182 DESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCR 246

  Fly   332 QEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSP 396
            :...:||....|...||:|||.|:|.|.|::                                  
Human   247 KVRETLAAETGLSVRVVQVWFQNQRAKMKKL---------------------------------- 277

  Fly   397 MGTHSHSHSPPMLSPQNMQSSAVAAHQLAAHXQSEIQESNSAAAASTPASLNSLSQQQQQQQQQQ 461
                :..|.    ..|..|:|.......... |...||..|:......||...|:..|||....:
Human   278 ----ARRHQ----QQQEQQNSQRLGQGEPGPGQGLGQEVLSSRMEGMMASYTPLAPPQQQIVAME 334

  Fly   462 QQQHQQQQQHQQQQHTPNTPSSSA-----GSSATMTSQVMSPQSPLGSSSAGN-QANNNN 515
            |..:......||....|..|.:.:     .|..::||   .....||||..|: ||...|
Human   335 QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTS---LSDCFLGSSDVGSLQARVGN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 1/2 (50%)
Homeobox 307..360 CDD:278475 17/52 (33%)
LMX1BNP_001167617.1 LIM1_Lmx1b 56..108 CDD:188757
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764
Homeobox 222..275 CDD:278475 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.