DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Pou1f1

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_006248036.1 Gene:Pou1f1 / 25517 RGDID:3367 Length:317 Species:Rattus norvegicus


Alignment Length:323 Identity:123/323 - (38%)
Similarity:163/323 - (50%) Gaps:58/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HHAAAAAAAHHQLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHPDPWMQTHHTHHLPAAAAVASA 110
            ||:||..     ||:|                                 .|.|:.:....::.|.
  Rat    28 HHSAAEG-----LPAS---------------------------------NHATNVMSTVPSILSL 54

  Fly   111 ADTVKQEMSHLSQQTRIQQGMASPHAAWHAPHAGHYAPTGGSPLQYHHAMNGML-----HHPAHA 170
            ..|.|...::.|..|   .|..:....:..|.. ||   |..|..| ..|.|.|     ..|.|.
  Rat    55 IQTPKCLHTYFSMTT---MGNTATGLHYSVPSC-HY---GNQPSTY-GVMAGTLTPCLYKFPDHT 111

  Fly   171 VAAAHHQSVAPLHHTLRGESPQL-HIHHHMGGGDRDAISGGEEDTPTSDDLEAFAKQFKQRRIKL 234
            ::    ....|||..|..|.|.. .....:....:......:.|:|...:||.||.:||.|||||
  Rat   112 LS----HGFPPLHQPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKL 172

  Fly   235 GFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIA 299
            |:||.:||.||..::|:.||||||||||.|||||||.||||.:|.||||||:. .|:..: :|:.
  Rat   173 GYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQ-VGALYN-EKVG 235

  Fly   300 AQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRM 362
            |..||||:||:|.::.|.|||:||.:..|||:|||..:|:.|.|||||||||||||||:|||:
  Rat   236 ANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 48/73 (66%)
Homeobox 307..360 CDD:278475 32/52 (62%)
Pou1f1XP_006248036.1 POU 150..224 CDD:197673 48/73 (66%)
Homeobox 243..297 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.