DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and POU5F2

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_694948.1 Gene:POU5F2 / 134187 HGNCID:26367 Length:328 Species:Homo sapiens


Alignment Length:294 Identity:102/294 - (34%)
Similarity:141/294 - (47%) Gaps:59/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AWHAPHAGHYAPT----GGSP-------------LQYHHAMNGMLHHPAHAVAAAHHQSV----- 179
            |.|.| :.|:.|.    ||.|             |....|...::..||..........|     
Human     2 AGHRP-SNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPL 65

  Fly   180 APLHHTLRGE----SPQLHIHHHMGGGD------RDAISG-------------GEEDTPTSDDLE 221
            .||.|..||.    .|:|....   .||      ..|:.|             .|:.:....:|:
Human    66 GPLPHEFRGWIAPCRPRLGASE---AGDWLRRPSEGALPGPYIALRSIPKLPPPEDISGILKELQ 127

  Fly   222 AFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLE--E 284
            ..||:.:|:|:.||::|||||:|:|.|:|.|.||||||||||.|||..||.||:|||:|||:  |
Human   128 QLAKELRQKRLSLGYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKLRPLLKKWLKEVE 192

  Fly   285 ADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVR 349
            |::..|. ..::.|..|..| .:|.|.|..:..:||:.|.:.|||:.|:|:.:|..|||:|:|||
Human   193 AENLLGL-CKMEMILQQSGK-WRRASRERRIGNSLEKFFQRCPKPTPQQISHIAGCLQLQKDVVR 255

  Fly   350 VWFCNRRQKEKRMT----PPNTLG--GDMMDGMP 377
            |||.||.:...|.|    |...:|  |....|.|
Human   256 VWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 41/75 (55%)
Homeobox 307..360 CDD:278475 24/52 (46%)
POU5F2NP_694948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 8/23 (35%)
Pou 124..192 CDD:278582 40/67 (60%)
Homeobox <225..261 CDD:278475 19/35 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.