DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Pou6f1

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:XP_038934171.1 Gene:Pou6f1 / 116545 RGDID:620615 Length:615 Species:Rattus norvegicus


Alignment Length:329 Identity:110/329 - (33%)
Similarity:153/329 - (46%) Gaps:50/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LPSSP---SP---NGQGNGGGLGLGSGSGLGSWSALHPDPWMQTHHTHHLPAAAAVASAADTVKQ 116
            :||.|   ||   |.||...|             ||   ||:....:...||.|..........|
  Rat   312 IPSMPGISSPILTNAQGQVIG-------------AL---PWVVNSASVATPAPAQSLQVQAVTPQ 360

  Fly   117 EMSHLSQQTRIQQGMAS-----PHAAWHAPHAGHYAPTGGSPLQYHHAMNG---MLHHPAHAVAA 173
            .:  |:.|.::...:||     |.|..........|.:...|:|...|:..   :|..||.|:..
  Rat   361 LL--LNAQGQVIATLASSPLPQPVAVRKPSTPESPAKSEVQPIQPTQAVPPPAVILTSPAPALKP 423

  Fly   174 AHHQSVAPLHHTLRGESP---QLHIHHHMGGGDRDAISGGEEDTPTSDDLEAFAKQFKQRRIKLG 235
            :   :.||:..|. .|:|   ||....|....|.|.|:        .:::..|||.||.||:.||
  Rat   424 S---ASAPIPITC-SETPTVSQLVSKPHTPSLDEDGIN--------LEEIREFAKNFKIRRLSLG 476

  Fly   236 FTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAD--STTGSPTSIDKI 298
            .||..||.||....|..:||:.|||||.|.::.|:..||||:|:|||.||:  :..|....::.:
  Rat   477 LTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFV 541

  Fly   299 AAQ-GRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRM 362
            ..: .:|||:|||.......||..:|.|.|.|:.||||.:|..|..::||||||||||||..|..
  Rat   542 GGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNT 606

  Fly   363 TPPN 366
            :..|
  Rat   607 SKLN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 34/73 (47%)
Homeobox 307..360 CDD:278475 27/52 (52%)
Pou6f1XP_038934171.1 PHA03247 <45..430 CDD:223021 33/138 (24%)
POU 453..527 CDD:197673 36/81 (44%)
Homeobox 551..605 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.