DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and Lmx1a

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_387501.1 Gene:Lmx1a / 110648 MGIID:1888519 Length:382 Species:Mus musculus


Alignment Length:145 Identity:34/145 - (23%)
Similarity:46/145 - (31%) Gaps:55/145 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 RKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEK------- 360
            |.::.||.:....:.|.:..|....||..:...:||....|...||:|||.|:|.|.|       
Mouse   194 RPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQ 258

  Fly   361 ----------RMTPPNTLGGDM--MDG-----------------------------------MPP 378
                      |:|...|.|...  |:|                                   ||.
Mouse   259 QQQQDQQNTQRLTSAQTNGSGNAGMEGIMNPYTTLPTPQQLLAIEQSVYNSDPFRQGLTPPQMPG 323

  Fly   379 GHMHHGGYHP-HHDM 392
            .|||..|..| .||:
Mouse   324 DHMHPYGAEPLFHDL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673
Homeobox 307..360 CDD:278475 17/52 (33%)
Lmx1aNP_387501.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 3/13 (23%)
Homeobox 198..252 CDD:365835 17/53 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..286 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.