DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vvl and pou3f2

DIOPT Version :9

Sequence 1:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001263306.1 Gene:pou3f2 / 100486226 -ID:- Length:382 Species:Xenopus tropicalis


Alignment Length:423 Identity:208/423 - (49%)
Similarity:228/423 - (53%) Gaps:119/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AAAAAAHHQLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHPDP--------------WMQTHHT- 98
            |..|:.|:.|                |||||     |.:|.:|              .:|:.:| 
 Frog     2 ATTASNHYNL----------------LGSGS-----SIVHSEPGGMQQAQSYRDAQTLVQSDYTL 45

  Fly    99 ----HHLPAA---AAVASAADTVKQEMSHLSQQ-----------------TRIQQGMASPHAAWH 139
                |.|..|   ....|..|......|.|.||                 |...||.| ||.. |
 Frog    46 QSNGHPLSHAHQWITALSHGDGAPWASSPLGQQDIKPSVQSSRDELHGAGTLQHQGRA-PHLV-H 108

  Fly   140 APHAGHYAP-----TGGSPL--------------QYHHAMNGM--------LHHPAHAVAAAHHQ 177
            ..|..|:.|     ||.:.|              |....:|||        :||  |.:..||..
 Frog   109 PAHGNHHGPGAWRSTGSAHLSSMASSNGQGLLYSQPSFTVNGMINPGSGQGMHH--HGLRDAHDD 171

  Fly   178 SVAPLHHTLRGESPQLHI---HHHMGGGDRDAISGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQA 239
                 ||...|..|....   |..:.||..|   ..:||||||||||.|||||||||||||||||
 Frog   172 -----HHGEHGHQPPPQTQQQHSQLQGGHHD---HSDEDTPTSDDLEQFAKQFKQRRIKLGFTQA 228

  Fly   240 DVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRK 304
            |||||||||||||||||||||||||||||||||||||||.||||||||::|||||||||||||||
 Frog   229 DVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRK 293

  Fly   305 RKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLG 369
            ||||||||||||||||.||.|.|||||||||||||||||||||||||||||||||||||||   |
 Frog   294 RKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPP---G 355

  Fly   370 GDMMDGMPPGHMHHGGYHPHHDMHGSPMGTHSH 402
            |.:     ||         ..|::|:...|..|
 Frog   356 GTI-----PG---------PEDVYGASRDTPPH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vvlNP_001303384.1 POU 212..286 CDD:197673 71/73 (97%)
Homeobox 307..360 CDD:278475 49/52 (94%)
pou3f2NP_001263306.1 POU 201..275 CDD:197673 71/73 (97%)
Homeobox 296..350 CDD:365835 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4743
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 308 1.000 Inparanoid score I2579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D328823at33208
OrthoFinder 1 1.000 - - FOG0000890
OrthoInspector 1 1.000 - - otm48484
Panther 1 1.100 - - LDO PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X514
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.