DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rsph3 and rsph3

DIOPT Version :9

Sequence 1:NP_648059.1 Gene:Rsph3 / 38751 FlyBaseID:FBgn0052392 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_998863.1 Gene:rsph3 / 407929 XenbaseID:XB-GENE-989659 Length:386 Species:Xenopus tropicalis


Alignment Length:328 Identity:130/328 - (39%)
Similarity:184/328 - (56%) Gaps:43/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 YKNVMYDRRVIKGSNFGNASLVTDVDP----FDKAAELRRRNMLRKRTMQCRNQRNVLGTPPPVK 386
            |.|:||||||::|:.:...:|.....|    |.:..|.:||.:.:||..:....|    ||..|:
 Frog    45 YGNIMYDRRVVRGNTYAQHTLPLSAQPDPIEFQRQQEAQRRALAKKRAKELLRPR----TPEAVE 105

  Fly   387 GRKHETIQTEKYLEKLVQRPPEFTIDTQTDLFLEKPPTPPFIPAKVGVDVATEIGEGELFHFDAE 451
            ||||..:|||.|||:|..|..|..::.|||.||::||||.|||||.|.||||:|.|||||.||.|
 Frog   106 GRKHIDVQTELYLEELSDRVEEKDMECQTDAFLDRPPTPLFIPAKTGADVATQILEGELFDFDLE 170

  Fly   452 AQPIIDVLVDACIEQSMLEVAHEMELSSLRRKQEEFLAQREAELAELRRLEAEELRLQAEKERRL 516
            .:|:::|||...|||::|||..|.||:.||.:|..|...|.|||||..|||.:|.|.:.|||||.
 Frog   171 VKPMLEVLVGKTIEQALLEVMEEEELAQLRAQQRAFEELRNAELAEAHRLEEQERRHREEKERRK 235

  Fly   517 RQ--DAIAKELDAEMQKSVTAAKLLQGHIASLVPEVLENIEPAS---DAVKKEQLMKSVCPWLSA 576
            :|  :.:.||  .|..:.|.|....|.::|.|||.|..::....   |.|::: :..:..|||  
 Frog   236 KQHREILLKE--KETAEKVAARAFAQQYLADLVPSVFSSLRDNGYFYDPVERD-VETTFMPWL-- 295

  Fly   577 EVAEEVGHIVD----SREILTAIIQEIIKQR--------AEIYAGY------KEPESE-----PS 618
              .|||.:|:.    .|.:|..||::::|:|        ::.|..|      :|.:||     |.
 Frog   296 --MEEVENIMKKNDLGRTMLDMIIRDVVKKRLADFQRATSQDYLKYEVNSQGQEIKSEKSVMQPQ 358

  Fly   619 GPD 621
            .||
 Frog   359 NPD 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rsph3NP_648059.1 Radial_spoke_3 326..604 CDD:283702 122/298 (41%)
rsph3NP_998863.1 Radial_spoke_3 45..326 CDD:399236 122/291 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I2992
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12043
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D406327at33208
OrthoFinder 1 1.000 - - FOG0006135
OrthoInspector 1 1.000 - - oto104886
Panther 1 1.100 - - LDO PTHR21648
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10534
SonicParanoid 1 1.000 - - X5066
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.