DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and IST1

DIOPT Version :10

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001257905.1 Gene:IST1 / 9798 HGNCID:28977 Length:379 Species:Homo sapiens


Alignment Length:167 Identity:37/167 - (22%)
Similarity:61/167 - (36%) Gaps:62/167 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EERSTPP----KTQTTTPLTAMNNPKSQKRL-RGLPLEE--------------RPD--------- 50
            :|||...    ....:||||..:.....||| ||..:|:              ||:         
Human  2060 DERSAGSLPLVSVSLSTPLTVADVAPHMKRLSRGRAVEDVLETLSDIDEMSRRRPEVLGFFSTNL 2124

  Fly    51 ----GPADRSRTCYKLRIWALALKN--QYKVLYGEFMSSF-FTLRSHD-EAVE-------EYP-- 98
                ..|:.|  |..| .::|||::  ....:..:|:.:| :.|.|.| |.|:       ||.  
Human  2125 QRLMSSAEES--CRNL-AFSLALRSIQNNPSIAADFLPTFMYCLGSRDFEVVQTALRNLPEYTLL 2186

  Fly    99 ----------RA----IYYQVETIYDTTSRYKLISFD 121
                      ||    :|.|::|....:...|::..:
Human  2187 CQEHAAVLLHRAFLVGVYGQIDTSAQISEALKILHME 2223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:460910 37/167 (22%)
PTZ00441 <273..>400 CDD:240420
IST1NP_001257905.1 Ist1 25..189 CDD:460910
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.