DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT1G79910

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_178109.2 Gene:AT1G79910 / 844330 AraportID:AT1G79910 Length:381 Species:Arabidopsis thaliana


Alignment Length:387 Identity:67/387 - (17%)
Similarity:133/387 - (34%) Gaps:112/387 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMV 72
            |.|.|:.:::...|:..:::||..:.:..:.:|.|.|.......|..|.|.:|.|...:...|.:
plant    11 YTKCKSLVKITKTRVDTVKRKKNSVCKYLKNDIVDLLKNSLDYNAYGRAEGLIEEKRRLACYEFL 75

  Fly    73 EMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSR 137
            |.:|:.:.:...|:.:.........|.::|||:...|: |::.||:.:..:|..:||        
plant    76 EQFCNCVASNVSLLQKSIRCPDECREAISSLVYAAARV-SEVPELRDLRSLFAERYG-------- 131

  Fly   138 TATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEPDPQVMQEDQPQQPH-------- 194
             .|.:.:|:.:.:.:...:.|.|.:....|..||:.|:|::  |.:.:::.....||        
plant   132 -NTLDQFVNPEFVERFKAEPPSKEMKVELLQEIAREYSIKW--DAKSLEQRLYTPPHHHHVHTET 193

  Fly   195 -------------------------------------LIDLSDRNNLSGGGGAGGGGAAPPQMGF 222
                                                 ::..|:.:::|..|....|....|:|  
plant   194 EEPKTEKTNSEPEKTMEKRSSLSFHGREDSMDDSNKSIMSTSEEDSMSTSGSCMTGPEDDPEM-- 256

  Fly   223 IGYPAMPALPDMPMPPSAKPFNYPPFGGGGGGGGGGAPAGAYALPHPVQAPPPFAYNIPPNQPPT 287
                              |||.|                 .:..|.|...|              
plant   257 ------------------KPFYY-----------------RFMTPAPYTKP-------------- 272

  Fly   288 HAVLPAKCAEEKDLNTNFIDREANNTDGSGSPDENILRPKPENDPPPRYTSINPVNLQNANK 349
             .:...:...||...::.:|.|:..   .|.|....:|.:..|.||...|....:.|:..:|
plant   273 -KIEKQESLPEKMTTSHLMDTESPT---GGKPKPRSVRRRFANPPPEAETEGEALKLKVESK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 35/164 (21%)
AT1G79910NP_178109.2 Ist1 15..170 CDD:367476 35/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302348at2759
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.