DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT1G51900

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_175602.1 Gene:AT1G51900 / 841617 AraportID:AT1G51900 Length:774 Species:Arabidopsis thaliana


Alignment Length:193 Identity:44/193 - (22%)
Similarity:88/193 - (45%) Gaps:34/193 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLL 79
            |:...:||.||:.:|...::..|.:|.|::.:..::.|..|.|.::..:..:.....:..:.|.:
plant    20 LKQLQSRLMLLKSQKYAKSRHLRADIVDFIRSNDSKSALFRTEQLLLVENAITIYGFLLKFTDFI 84

  Fly    80 LARFG--------LITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQS 136
            |.||.        |:..    ||  :|.|:||::...:.: :|.||.|||::...:|        
plant    85 LLRFSPSKKHSCLLVND----DT--SEAVSSLIFASVKCR-EIPELLIISELVGQRY-------- 134

  Fly   137 RTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEPDP-QVMQEDQPQQPHLIDL 198
                |:.||:      ..:|.||..||...:....|:.::..|.|. :||:|...:..:.:::
plant   135 ----GQRYVT------TAIQVPPGNLVNTEIKEKLKSTSVVSETDKCRVMEEIAKESGYRLEI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 39/169 (23%)
AT1G51900NP_175602.1 Ist1 20..182 CDD:281401 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302348at2759
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.