DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT1G25420

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_564235.1 Gene:AT1G25420 / 839128 AraportID:AT1G25420 Length:323 Species:Arabidopsis thaliana


Alignment Length:281 Identity:83/281 - (29%)
Similarity:132/281 - (46%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSGPNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYL 65
            :|:.|....|.||:|.||:.|:|||:.|:....:..:||||.:|..|:...|||||||:|||..|
plant     7 LFNRGIFGAKCKTSLNLAIARMKLLQNKRDMQLKHMKKEIAHFLQAGQEPIARIRVEHVIREMNL 71

  Fly    66 VEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGP 130
            ..|.|::|::|:.:|||..::...||....:.|.:||:::..||. |::.:|..|.::|.||||.
plant    72 WAAYEILELFCEFILARVPILESEKECPRELREAIASIIFAAPRC-SEVPDLLQIKNLFGTKYGK 135

  Fly   131 QF---AEQSRTATGEHYVSEKLMHKLTLQAPP-----KLLVENYLIAIAKNYNIEYEPDPQVMQE 187
            :|   |.:.|..:|   |:..::.||:..:|.     |:|.|     ||:.|::.::..   ..|
plant   136 EFIMVASELRPDSG---VNRTIIEKLSPTSPSGAARLKMLKE-----IAQEYSLNWDSS---ATE 189

  Fly   188 DQPQQPHLIDLSDRNNLSGGGGA-----GGGGAAPPQMGF---------IGYPA----------- 227
            .:..:.|       .:|.||...     |...:.|.|.|:         ...||           
plant   190 AEFMKSH-------EDLLGGAKQIHRQDGISESRPSQQGYGQSSVSREVESLPAEATQRFQKLQA 247

  Fly   228 -MPALPDMPMPPSAKPFNYPP 247
             .|....||.......|..||
plant   248 QNPVSKSMPSSKLTSAFQAPP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 63/172 (37%)
AT1G25420NP_564235.1 Ist1 18..182 CDD:281401 63/172 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2030
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302348at2759
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 1 1.000 - - otm2872
orthoMCL 1 0.900 - - OOG6_102849
Panther 1 1.100 - - LDO PTHR12161
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2350
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.