DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT1G13340

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_172792.1 Gene:AT1G13340 / 837894 AraportID:AT1G13340 Length:409 Species:Arabidopsis thaliana


Alignment Length:206 Identity:50/206 - (24%)
Similarity:96/206 - (46%) Gaps:3/206 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVE 73
            ||.|:.:.|||.||.:|:.::.....::..::.:.|..|:.|.|..||:.::::...::.:..:.
plant    16 NKFKSLITLALTRLSILKNQRQARLSQAISDVTELLKLGQHEHAYHRVDQVVKDQNTLDVLFFIH 80

  Fly    74 MYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRT 138
            .|..|.|.|..|....::....:.|.|:.|::...|: .:..||:.|.::.::::|...|.:|..
plant    81 GYFTLCLDRIHLFEHNRDCPEELLEAVSGLLFAASRI-GEFPELQEIRNVLISRFGKDLAARSIE 144

  Fly   139 ATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEPD-PQVMQEDQPQQPHLIDLSDRN 202
            ......|..|::.||:.:.|||.:....|..||...||..:.| .....|.........|:| :.
plant   145 LRSNCGVDPKIIQKLSTRPPPKEVRMKALKEIAAENNIVLKLDQASTSTEGTTNMQGTSDVS-KT 208

  Fly   203 NLSGGGGAGGG 213
            .|:...|.|.|
plant   209 KLTSKDGRGEG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 39/164 (24%)
AT1G13340NP_172792.1 Ist1 19..182 CDD:281401 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302348at2759
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.