DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT3G15490

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_188168.2 Gene:AT3G15490 / 820788 AraportID:AT3G15490 Length:211 Species:Arabidopsis thaliana


Alignment Length:107 Identity:21/107 - (19%)
Similarity:53/107 - (49%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELD--- 93
            :.::||.:||..|:.|:...|..:.:....::..:.|.:.||::|..:|.....:.....:|   
plant     1 MVRQSRSDIAQLLSYGRYSEALPKAKQFYEDERRLSAYDQVELFCTTILQNISSLKYENNVDLLP 65

  Fly    94 TGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQ 135
            ....:.:|.:::...|: .::.:|:.|...||.::|.:|.::
plant    66 EETKKAMAGIIFAASRI-GELEDLQHIRSFFVQRFGLKFDKE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 21/107 (20%)
AT3G15490NP_188168.2 Ist1 1..147 CDD:281401 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12161
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.