DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ist1 and AT1G52315

DIOPT Version :9

Sequence 1:NP_648058.1 Gene:Ist1 / 38750 FlyBaseID:FBgn0035715 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_974006.1 Gene:AT1G52315 / 2745821 AraportID:AT1G52315 Length:347 Species:Arabidopsis thaliana


Alignment Length:180 Identity:40/180 - (22%)
Similarity:83/180 - (46%) Gaps:19/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMV 72
            |.|.|:.......|:.::.:|:..:.:..:.:|.::|..|:...|..|.|.::.|..::...:::
plant    11 YKKSKSTTSYMKIRIDIVRRKRIAMVRNYKTDIVNFLKNGQDSEAYRRAELLLEELRIISCYDLI 75

  Fly    73 EMYCDLLLARFGLITQMKELDTGIAEPVASLV----WVCPRLQSDIAELKIISDIFVTKYGPQFA 133
            |.:||.:.....|:.:.:|......|.|:||:    ||     .|:.|||.:..:|..::|...|
plant    76 ERFCDCISENLSLMLKKRECPEECREAVSSLIYATAWV-----PDVPELKDLRAVFTKRFGNFIA 135

  Fly   134 EQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIA-IAKNYNIEYEPDP 182
            ..         |:.:|:.|..|..||...::...:. :|..::|.::|.|
plant   136 SS---------VNHELVEKTELLRPPSRELKIQTVKDVANEFSINWDPTP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ist1NP_648058.1 Ist1 12..177 CDD:281401 35/169 (21%)
AT1G52315NP_974006.1 Ist1 24..171 CDD:397459 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1302348at2759
OrthoFinder 1 1.000 - - FOG0001089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.