DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASL11A and CG8519

DIOPT Version :9

Sequence 1:NP_996563.1 Gene:RASL11A / 387496 HGNCID:23802 Length:242 Species:Homo sapiens
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:192 Identity:76/192 - (39%)
Similarity:114/192 - (59%) Gaps:23/192 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    27 DIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDT-PGGVQIQD 90
            ::|:||:||..|||||:||||||||:||:|:..|...|.....|:|:.:..:|.|| |   :.:|
  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCP---KAED 76

Human    91 SLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHPD--SKAPVIIVGNKGDLLH 153
            ..|    :.::.||||:|.||||||||       |..:.:||:...|  |..||.:..||.|::|
  Fly    77 EYP----NAAELVQWADGLLLVYSITD-------RKSFNYIRRAKSDLQSDTPVQLCANKVDMVH 130

Human   154 ARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQHLCKEVSKMHGLSGERR-RASIIPR 214
            .|||...:|..||.:....|.|:|.:::.:.|.:||..|||||     |:.:|: :.|::.|
  Fly   131 LRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV-----LASKRKSKQSLLER 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASL11ANP_996563.1 Small GTPase-like 17..241 76/192 (40%)
RERG_RasL11_like 29..198 CDD:206713 72/171 (42%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 70/171 (41%)
P-loop_NTPase 17..173 CDD:304359 70/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45783
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5611
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.