Sequence 1: | NP_996563.1 | Gene: | RASL11A / 387496 | HGNCID: | 23802 | Length: | 242 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163165.1 | Gene: | Ric / 36776 | FlyBaseID: | FBgn0265605 | Length: | 264 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 99/201 - (49%) | Gaps: | 27/201 - (13%) |
- Green bases have known domain annotations that are detailed below.
Human 14 PIPESSSDYLLPKDI-------KLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVE 71
Human 72 GDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHP 136
Human 137 DSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTS-ENYEDVCDVFQHLCKEV--SK 198
Human 199 MHGLSG 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RASL11A | NP_996563.1 | Small GTPase-like | 17..241 | 56/198 (28%) | |
RERG_RasL11_like | 29..198 | CDD:206713 | 52/171 (30%) | ||
Ric | NP_001163165.1 | Rit_Rin_Ric | 58..229 | CDD:206712 | 54/179 (30%) |
small_GTPase | 58..223 | CDD:197466 | 52/173 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0395 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D563049at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |