DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASL11A and Ric

DIOPT Version :9

Sequence 1:NP_996563.1 Gene:RASL11A / 387496 HGNCID:23802 Length:242 Species:Homo sapiens
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:99/201 - (49%) Gaps:27/201 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    14 PIPESSSDYLLPKDI-------KLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVE 71
            |:|        |:::       |:.:||.|.|||||:.::|::..|:..::|.....|.:...::
  Fly    47 PVP--------PQNMRGGLRVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVID 103

Human    72 GDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDSYLSIRPLYQHIRKVHP 136
            .:...|.|.||.|.|:    ...:.|...:|   .|||::.||:||..|:.......:.|.:|..
  Fly   104 NEAALLDILDTAGQVE----FTAMRDQYMRC---GEGFIICYSVTDRHSFQEASEYRKLITRVRL 161

Human   137 DSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTS-ENYEDVCDVFQHLCKEV--SK 198
            ....|::::.||.||...|:|.|::|..|||:.|..|.|.|.: .:|.|  :.|..|.:|:  .:
  Fly   162 SEDIPLVLIANKVDLESQRRVTTEEGRNLANQFGCPFFETSAALRHYID--EAFYTLVREIRRKE 224

Human   199 MHGLSG 204
            ||...|
  Fly   225 MHKALG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASL11ANP_996563.1 Small GTPase-like 17..241 56/198 (28%)
RERG_RasL11_like 29..198 CDD:206713 52/171 (30%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 54/179 (30%)
small_GTPase 58..223 CDD:197466 52/173 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.