DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and AT1G43860

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_564488.1 Gene:AT1G43860 / 840982 AraportID:AT1G43860 Length:370 Species:Arabidopsis thaliana


Alignment Length:258 Identity:119/258 - (46%)
Similarity:162/258 - (62%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSK-IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKG 64
            ||| :..|..|.||||||:|||||.|.||||||||||||||||..|||||||||:|||::|||||
plant     1 MSKTLVQPVGQKRLTNVAVVRLKKQGNRFEIACYKNKVLSWRSGVEKDIDEVLQSHTVYSNVSKG 65

  Fly    65 QAAKKDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPY 129
            ..||..:|.|:|...|.|:||.:||.||||||:.|||:|...:|...|...|....:||||:|||
plant    66 VLAKSKDLMKSFGSDDHTKICIDILEKGELQVAGKERESQFSSQFRDIATIVMQKTINPETQRPY 130

  Fly   130 PASIIEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGG---KLKE- 190
            ..|::|:.:.:.||:|..:.|:|:..|:.|:.|:.|.||:||.|:||::...:....   |||| 
plant   131 TISMVERLMHEIHFAVDPHSNSKKQALDVIRELQKHFPIKRSPMRLRLTVPVQNFPSLLEKLKEW 195

  Fly   191 --SVVKLANAVEHEEWDEATLHLTLL--IDPGQYRVIDELVRNETKGKGLLELLELKEVVESE 249
              |||..         ||:...::.:  ::||.:|..|..||:.   :|.||:|.:....|.:
plant   196 DGSVVSK---------DESGTQMSTVCEMEPGLFRECDSHVRSI---QGRLEILAVSVHAEGD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 109/229 (48%)
AT1G43860NP_564488.1 PTZ00448 4..351 CDD:185627 116/255 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1763
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 203 1.000 Inparanoid score I1300
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto3487
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.