DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and Sbds

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_075737.1 Gene:Sbds / 66711 MGIID:1913961 Length:250 Species:Mus musculus


Alignment Length:249 Identity:148/249 - (59%)
Similarity:186/249 - (74%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:|:||||||||||||||:.|||..|||:|||||||:||.||||||.||
Mouse     3 IFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|..||...|:|||||:||:|||:|||:|||.:.|:.....|...||..||||||:|||...:
Mouse    68 KEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVIL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||.|::|||..||.||.||:.|.|||:.|:||......| |.||||.:..|...
Mouse   133 IERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNE-GKKLKEKLKPLMKV 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            ||.|::.: .|.:..|||||.:|.||||::.||||:|.||:|.||:|.|.:|.|
Mouse   197 VESEDYSQ-QLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 132/221 (60%)
SbdsNP_075737.1 Sdo1 9..241 CDD:224417 137/233 (59%)
SBDS 17..98 CDD:279511 58/80 (73%)
SBDS_C 107..224 CDD:286465 57/118 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850588
Domainoid 1 1.000 139 1.000 Domainoid score I4774
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 291 1.000 Inparanoid score I2775
Isobase 1 0.950 - 0 Normalized mean entropy S584
OMA 1 1.010 - - QHG54247
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto92053
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.710

Return to query results.
Submit another query.