DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and SBDS

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_057122.2 Gene:SBDS / 51119 HGNCID:19440 Length:250 Species:Homo sapiens


Alignment Length:249 Identity:147/249 - (59%)
Similarity:185/249 - (74%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:|:.|||||||||||||:.|||..|||:|||||||:||.||||||.||
Human     3 IFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|..||...|:|||||:||:|||:|||:|||.:.|:.....|...||..||||||:|||...:
Human    68 KEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVIL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||.|::|||..||.||.||:.|.|||:.|:||......| |.||||.:..|...
Human   133 IERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNE-GKKLKEKLKPLIKV 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            :|.|::.: .|.:..|||||.:|.||||::.||||||.||:|.||:|.|.:|.|
Human   197 IESEDYGQ-QLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 130/221 (59%)
SBDSNP_057122.2 PTZ00448 1..>223 CDD:185627 130/221 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160214
Domainoid 1 1.000 136 1.000 Domainoid score I4947
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 290 1.000 Inparanoid score I2817
Isobase 1 0.950 - 0 Normalized mean entropy S584
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto88482
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1300
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.