DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and sbds

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004953.1 Gene:sbds / 448365 XenbaseID:XB-GENE-1003506 Length:250 Species:Xenopus tropicalis


Alignment Length:249 Identity:153/249 - (61%)
Similarity:188/249 - (75%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:||||||||||||||||:||||.:|||:|||||||:||.||||||.||
 Frog     3 IFTPTNQIRLTNVAVVRMKKGGKRFEIACYKNKVMSWRSGAEKDLDEVLQTHSVFMNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|.|:|...|.|||||:||||||||||||||.:.|:.....|...||..||||||:|||..::
 Frog    68 KEDLLKSFGTEDPTEICKQILSKGELQVSEKERSTQLEQMFRDIATIVADKCVNPETKRPYTVNL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||..::|||..|:.||.||:.|.|||:.|:||.....|: |.||||.:..|...
 Frog   133 IERAMKDIHYSVKATKSTKQQALDVIKQLKETMQIERAHMRLRFILPAKD-GKKLKEKLKPLIKH 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            .|.|.:|: .|.:..|||||.:|.||||:|.||||||.||:|.||:|.|.:|.|
 Frog   197 TESENFDQ-ELEIVCLIDPGCFREIDELIRCETKGKGTLEVLSLKDVEEGDEKF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 135/221 (61%)
sbdsNP_001004953.1 PTZ00448 1..>223 CDD:185627 135/221 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4526
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 299 1.000 Inparanoid score I2665
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto102360
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1300
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.