DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and sdo1

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_593869.1 Gene:sdo1 / 2543459 PomBaseID:SPAC4F8.03 Length:246 Species:Schizosaccharomyces pombe


Alignment Length:243 Identity:122/243 - (50%)
Similarity:167/243 - (68%) Gaps:4/243 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            |..|..|||||||::|:.||||||||:|||||||..||:..|.|:|||||.|.||.|||||..|.
pombe     3 ISQPVGQIRLTNVSVVKYKKGGKRFEVACYKNKVTEWRNKIETDLDEVLQIHNVFNNVSKGHVAS 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            :.:|:|||...|..:|..|||.||:.||.||||...:.:....||:.|.|:|::|.::|||||||
pombe    68 RQDLKKAFGTDDIDKIILEILQKGDFQVGEKERHHQMSSTYRDIVSHVTAMCMDPNSKRPYPASI 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKIL--KDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLA 196
            |||:|.|..|||..::..|...|||||.|  |:.:||.|:||::|:....|:|.. |:|.:..||
pombe   133 IEKALSDCGFSVSTSKTAKSQALEAIKKLQEKNEIPIVRARMRIRIVVDVKQGKA-LRERLRSLA 196

  Fly   197 NAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKE 244
            :.:|.|..|:....:.|:| ||.|::||||||||||.:|::::|::.|
pombe   197 DEIEEENIDDEYECIALVI-PGNYKLIDELVRNETKNRGMVQVLDMSE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 111/223 (50%)
sdo1NP_593869.1 Sdo1 9..245 CDD:224417 120/237 (51%)
SBDS 17..98 CDD:279511 47/80 (59%)
SBDS_C 108..226 CDD:286465 52/119 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I1565
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 235 1.000 Inparanoid score I838
OMA 1 1.010 - - QHG54247
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto100498
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1300
SonicParanoid 1 1.000 - - X3393
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.