DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and sbds-1

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_497226.2 Gene:sbds-1 / 175218 WormBaseID:WBGene00021063 Length:253 Species:Caenorhabditis elegans


Alignment Length:253 Identity:146/253 - (57%)
Similarity:190/253 - (75%) Gaps:8/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSK-IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKG 64
            ||| |.|||||..|||||:||:||.|||||||||||||::||:.|||||||||||||||:|||||
 Worm     1 MSKNIKTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKG 65

  Fly    65 QAAKKDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPY 129
            |.:||:||..||...|:.||||.||.||:|||||||||:..|..|..:...:|::.|||||:||.
 Worm    66 QLSKKEELIAAFGIEDQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPV 130

  Fly   130 PASIIEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGG---KLKES 191
            |.|:|:|:|::.|||:|.||::||..|:||..|::.:.|||::||:||:...||...   |||  
 Worm   131 PPSVIDKALQEMHFSLKPNRSSKQQALDAIPKLRETLKIERAKMKIRVAIPTKEAKSVHTKLK-- 193

  Fly   192 VVKLANAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESE 249
              .|.:.||.::|.:.:|.:..||:||.:|.:|:||||||||.|.||:|.||:|||.|
 Worm   194 --TLFSDVEVDDWQDGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEILSLKDVVEGE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 125/224 (56%)
sbds-1NP_497226.2 Sdo1 11..244 CDD:224417 133/236 (56%)
SBDS 19..100 CDD:279511 59/80 (74%)
SBDS_C 111..227 CDD:286465 48/119 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167693
Domainoid 1 1.000 138 1.000 Domainoid score I3027
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 279 1.000 Inparanoid score I1768
Isobase 1 0.950 - 0 Normalized mean entropy S584
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto17909
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1300
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.