DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dikar and GCN5

DIOPT Version :10

Sequence 1:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster
Sequence 2:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:43/104 - (41%)
Similarity:61/104 - (58%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 MHKVLVYVKNHRDAWPFVDPVEEDIAPRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIV 960
            :..:|..::||..||||:.||.::..|.||..|:.||||..||.||:|.:|.|..:|..|.||:.
Yeast   336 IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF 400

  Fly   961 NNCRLYNGHNNEYTEMVNNLQDAFEKATKKY--FDNLSD 997
            ||||:|||.|..|.:..|.|:..|....|:.  :.:|.|
Yeast   401 NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dikarNP_001261480.1 Bromo_gcn5_like 892..991 CDD:99941 41/94 (44%)
PTZ00449 <1941..2257 CDD:185628
PRK10263 <2224..>2332 CDD:236669
GCN5NP_011768.1 COG5076 77..439 CDD:227408 42/102 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.