DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dikar and kat2a

DIOPT Version :9

Sequence 1:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster
Sequence 2:XP_009297593.1 Gene:kat2a / 555517 ZFINID:ZDB-GENE-080403-11 Length:795 Species:Danio rerio


Alignment Length:97 Identity:36/97 - (37%)
Similarity:55/97 - (56%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 MHKVLVYVKNHRDAWPFVDPVEEDIAPRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIV 960
            :..:|..:|.|.|||||::||::..||.||.:||.|:||..|.::|.:..|.....|..|.:.::
Zfish   695 LKNLLAQIKTHPDAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVI 759

  Fly   961 NNCRLYNGHNNEYTEMVNNLQDAFEKATKKYF 992
            .|||.||..::||.:..|.|:..|      ||
Zfish   760 TNCREYNPPDSEYCKSANTLEKFF------YF 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dikarNP_001261480.1 WHIM1 100..148 CDD:292246
Bromo_gcn5_like 892..991 CDD:99941 34/94 (36%)
kat2aXP_009297593.1 PCAF_N 49..295 CDD:368925
COG5076 450..789 CDD:227408 36/97 (37%)
Bromo_gcn5_like 691..789 CDD:99941 36/97 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.