DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dikar and Brd8dc

DIOPT Version :9

Sequence 1:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster
Sequence 2:NP_808441.2 Gene:Brd8dc / 271508 MGIID:3045347 Length:273 Species:Mus musculus


Alignment Length:114 Identity:36/114 - (31%)
Similarity:55/114 - (48%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   876 SSNHANILS--------FTETEEVLQIGMHKVLVYVKNHRDAWPFVDPVEEDIAPRYYSIIRRPM 932
            ||:..|.||        |...:.:||     |...:.:||.:.||:.||.|..||.|..:::|||
Mouse   141 SSSQLNDLSQGDPIQDQFLFKKTLLQ-----VWKMIASHRFSSPFLKPVSEKQAPGYKDVVKRPM 200

  Fly   933 DLLKMEDKLDSGEYHKFSEFRNDFRLIVNNCRLYNGHNNEYTEMVNNLQ 981
            ||..::..|..|..|..:||:.|..|:..|..:||..::....|...:|
Mouse   201 DLTTLKRNLSKGRIHTMAEFQRDLMLMFQNAVMYNDSDHHIYHMAVEMQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dikarNP_001261480.1 WHIM1 100..148 CDD:292246
Bromo_gcn5_like 892..991 CDD:99941 30/90 (33%)
Brd8dcNP_808441.2 Bromo_brd8_like 160..259 CDD:99939 30/95 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.