DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dikar and Kat2b

DIOPT Version :10

Sequence 1:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster
Sequence 2:NP_064389.2 Gene:Kat2b / 18519 MGIID:1343094 Length:813 Species:Mus musculus


Alignment Length:101 Identity:37/101 - (36%)
Similarity:55/101 - (54%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   890 EVLQIGMHKVLVYVKNHRDAWPFVDPVEEDIAPRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRN 954
            |.|...:..:|..||||.:||||::||:...||.||.:||.||||..|.::|.:..|.....|..
Mouse   707 EQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMA 771

  Fly   955 DFRLIVNNCRLYNGHNNEYTEMVNNLQDAFEKATKK 990
            |.:.:..||:.||...:||.:..:.|:..|....|:
Mouse   772 DLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKE 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dikarNP_001261480.1 Bromo_gcn5_like 892..991 CDD:99941 36/99 (36%)
PTZ00449 <1941..2257 CDD:185628
PRK10263 <2224..>2332 CDD:236669
Kat2bNP_064389.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
PCAF_N 56..307 CDD:461923
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..423
COG5076 468..807 CDD:227408 36/99 (36%)
Bromo_gcn5_like 708..807 CDD:99941 35/98 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.