Sequence 1: | NP_001261480.1 | Gene: | dikar / 38747 | FlyBaseID: | FBgn0261934 | Length: | 3261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508124.1 | Gene: | F13C5.2 / 180410 | WormBaseID: | WBGene00017423 | Length: | 374 | Species: | Caenorhabditis elegans |
Alignment Length: | 233 | Identity: | 59/233 - (25%) |
---|---|---|---|
Similarity: | 102/233 - (43%) | Gaps: | 56/233 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 902 YVKNHRDA--WPFVDPVEEDI--APRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIVNN 962
Fly 963 CRLYNGHNNEYTEMVNNLQDAFEKATKKYF----DNL---------SDDEDDDPNLSYPAADSKM 1014
Fly 1015 NVFREKYFSKKAKEETEKDAPGRPAVSSAEEDLSEIEAEAPQKAQKRKRKEKDKRRKKKTKSKAD 1079
Fly 1080 VE--TDDEDME----------AEREPTPPPPPPTSKKS 1105 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dikar | NP_001261480.1 | WHIM1 | 100..148 | CDD:292246 | |
Bromo_gcn5_like | 892..991 | CDD:99941 | 27/92 (29%) | ||
F13C5.2 | NP_508124.1 | Bromodomain | 118..219 | CDD:383021 | 26/89 (29%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |