DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dikar and pcaf-1

DIOPT Version :9

Sequence 1:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster
Sequence 2:NP_491173.1 Gene:pcaf-1 / 171920 WormBaseID:WBGene00021636 Length:767 Species:Caenorhabditis elegans


Alignment Length:120 Identity:34/120 - (28%)
Similarity:45/120 - (37%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 MHKVLVYVKNHRD-------------------AWPFVDPVEEDIAPRYYSIIRRPMDLLKMEDKL 941
            |||...|..:.||                   ||||..||:....|.||..|:.|:|...|::||
 Worm   636 MHKKSCYHLDERDDSLDSKIGAILKKLTADKNAWPFASPVDVKEVPEYYDHIKHPIDFKTMQEKL 700

  Fly   942 DSGEYHKFSEFRNDFRLIVNNCRLYNGHNNEYTEMVNNLQDAFEKATKKYFDNLS 996
            ....|.....|..|...:..||.::||....|.:....|.:...|..|..|...|
 Worm   701 KRKAYTHQHLFIADLNRLFQNCYVFNGAEAVYYKYGYKLNELALKLLKTSFPESS 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dikarNP_001261480.1 WHIM1 100..148 CDD:292246
Bromo_gcn5_like 892..991 CDD:99941 32/113 (28%)
pcaf-1NP_491173.1 PCAF_N 9..247 CDD:283997
COG5076 408..735 CDD:227408 29/98 (30%)
Acetyltransf_1 476..544 CDD:278980
Bromo_gcn5_like 650..748 CDD:99941 25/97 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.