DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rasl12

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001028330.2 Gene:Rasl12 / 70784 MGIID:1918034 Length:266 Species:Mus musculus


Alignment Length:184 Identity:74/184 - (40%)
Similarity:101/184 - (54%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            |:.:|::|....|||||.|:|||||:|.|||...|:.|..|..||.:||...::||   |:.:.|
Mouse    20 EVNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPVHLRVMDT---ADLDTP 81

  Fly    80 -NAAELVQWADGLLLVYSITDRKSF----NYIR----RAKSDLQSDTPVQLCANKVDMVHLRQVS 135
             |....:.||...|:|||:..|.||    :|:.    .|| :.|...|..|..||:||...|||:
Mouse    82 RNCERYLNWAHAFLVVYSVDSRASFEGSSSYLELLALHAK-ETQRGYPALLLGNKLDMAQYRQVT 145

  Fly   136 RDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERML 189
            :.||..||..|.|.|.||||....:.|..||:|..:||   :|:..:|.|.|.|
Mouse   146 KAEGAALAGRFGCLFFEVSACLDFEHVQHVFHEAVREV---RRELDKSPLARPL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 67/166 (40%)
P-loop_NTPase 17..173 CDD:304359 66/164 (40%)
Rasl12NP_001028330.2 RERG_RasL11_like 22..185 CDD:206713 68/169 (40%)
RAS 23..185 CDD:214541 68/168 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.