DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rasl11a

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_081140.1 Gene:Rasl11a / 68895 MGIID:1916145 Length:242 Species:Mus musculus


Alignment Length:193 Identity:75/193 - (38%)
Similarity:108/193 - (55%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCP---KAED 76
            ::|:||:||..|||||:||||||||:||:|:..|...|.....|:|:.:..:|.|| |   :|:|
Mouse    27 DIKLAVLGAGCVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDT-PGGIQAQD 90

  Fly    77 E----YPNAAELVQWADGLLLVYSITDRKS-------FNYIRRAKSDLQSDTPVQLCANKVDMVH 130
            .    ..:..:.|.||:|.||||||||.:|       :.:||:...|  ...|:.:..||.|::|
Mouse    91 SLSQMVDSLTKSVHWAEGFLLVYSITDYESYQSIRPLYQHIRKVHPD--GKAPIFIVGNKGDLLH 153

  Fly   131 LRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGAR 193
            .|||...||..||.:....|.|:|.:::.:.|.:||..|||||:...|          |||.|
Mouse   154 ARQVQTHEGLQLANELGSLFLEISTSENYEDVCDVFQHLCKEVIKVHR----------LGGER 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 68/171 (40%)
P-loop_NTPase 17..173 CDD:304359 68/169 (40%)
Rasl11aNP_081140.1 Small GTPase-like 17..241 75/193 (39%)
small_GTPase 26..198 CDD:197466 70/173 (40%)
RERG_RasL11_like 29..196 CDD:206713 68/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45783
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5611
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.910

Return to query results.
Submit another query.