DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and RASL11B

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_076429.1 Gene:RASL11B / 65997 HGNCID:23804 Length:248 Species:Homo sapiens


Alignment Length:188 Identity:69/188 - (36%)
Similarity:109/188 - (57%) Gaps:16/188 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDT--CPKAEDEY 78
            :||||:||..|||:||:|||||||:||:|:....|.|..:..::||.:..::.||  ....|:..
Human    34 VKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSL 98

  Fly    79 PNAAEL---VQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVHLRQVS 135
            ..:.:|   ::|||.:::|:||||.||:..|.:....:|     :..||.:.|||.|::|::||.
Human    99 SCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVD 163

  Fly   136 RDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV------LASKRKSKQSLLER 187
            ...|..||....|.|.|||.:::.:.|...|:.|||||      .::..|.:.||:.|
Human   164 PQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 63/166 (38%)
P-loop_NTPase 17..173 CDD:304359 63/165 (38%)
RASL11BNP_076429.1 Small GTPase-like 29..246 69/188 (37%)
RERG_RasL11_like 35..203 CDD:206713 65/167 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..226 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.