DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rem2

DIOPT Version :10

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_073176.2 Gene:Rem2 / 64626 RGDID:69081 Length:341 Species:Rattus norvegicus


Alignment Length:186 Identity:57/186 - (30%)
Similarity:85/186 - (45%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTEN---RYKHEAMVDGEPVLFEILDTCPKAEDEY 78
            |:.::|...||||.|...|...:  |:..|:.||   .|:...|||.|.|...:.|...:.:...
  Rat   117 KVMLLGESGVGKSTLAGTFGGLQ--GDNAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGG 179

  Fly    79 PNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQS-----DTPVQLCANKVDMVHLRQVSRDE 138
            ......:|..|..|:|:|:|||:||:.:......|::     |.||.|..||.|:...|:||.:|
  Rat   180 WLQDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEE 244

  Fly   139 GEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGARP 194
            |..||....||..|.|||.| ....|:|....:::...:.:..       .||.||
  Rat   245 GRHLAGTLSCKHIETSAALH-HNTRELFEGAVRQIRLRRGRGH-------AGGQRP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 P-loop containing Nucleoside Triphosphate Hydrolases 17..173 CDD:476819 53/163 (33%)
Rem2NP_073176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..106
RGK 116..341 CDD:206715 57/186 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.