DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rergl

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001121562.1 Gene:Rergl / 632971 MGIID:3642998 Length:204 Species:Mus musculus


Alignment Length:199 Identity:73/199 - (36%)
Similarity:107/199 - (53%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            |:|:||:|....|||||.|||||||:||||....|:.|.....::|:|:..||.|.|.:.:....
Mouse     3 EVKLAVLGGKGTGKSALTVRFLTKRFIGEYASNFESVYNKHLCLEGKPLNLEIYDPCSQPQKAKC 67

  Fly    80 NAAELVQWADGLLLVYSITDRKSFNY----IRRAKSDLQS------DTPVQLCANKVDMVHLRQV 134
            :....:.||||.|:||.|::|.||.:    |.|.:....:      :..|.|..||.|:.|:|:|
Mouse    68 SLTSELHWADGFLIVYDISNRPSFAFAQALIYRIREPPTTHCKRVVEPAVVLVGNKQDLCHMREV 132

  Fly   135 SRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVL----------ASKRKSKQSLLERML 189
            ..:||:.||.||.|:|.|:|||:...:|..:|..|.|::|          .|..||...|:..:.
Mouse   133 GWEEGQKLAIDFRCQFCELSAAEQSLEVEVMFLRLIKDILMIFKHKEKRRPSGSKSMAKLINNVF 197

  Fly   190 GGAR 193
            |..|
Mouse   198 GKRR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 66/167 (40%)
P-loop_NTPase 17..173 CDD:304359 65/165 (39%)
RerglNP_001121562.1 small_GTPase 3..171 CDD:197466 66/167 (40%)
RERG_RasL11_like 5..171 CDD:206713 65/165 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0004892
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.