DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rerglb

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001038581.1 Gene:rerglb / 566719 ZFINID:ZDB-GENE-040724-73 Length:203 Species:Danio rerio


Alignment Length:200 Identity:72/200 - (36%)
Similarity:116/200 - (57%) Gaps:17/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDE 77
            :.::|:|::|:...||||::|||||||:||||.....:.|.....:||..:..|:.|.|.::.:.
Zfish     1 MNDIKLALLGSEGAGKSAVLVRFLTKRFIGEYASNANSLYHKRLSIDGRQLNLEVFDPCSQSGES 65

  Fly    78 YPNAAELVQWADGLLLVYSITDRKSF----NYIRRAKSD----LQSDTPVQLCANKVDMVHLRQV 134
            .....|.|.||||.::||:|:||.||    |.:.:.|..    .:.:.||.|..||.|:.|.|||
Zfish    66 RCILEEPVDWADGFVVVYTISDRTSFLNAKNILAQIKESRRETCKGEVPVCLVGNKQDLCHSRQV 130

  Fly   135 SRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGARPYSRGK 199
            |.:||.:|:::::|.|.|||||::..:::.:|.:|.:.|:       :.|..|  |..|.||..|
Zfish   131 SEEEGRVLSQEYKCLFQEVSAAENYLEISNLFTKLIRHVM-------EQLKHR--GDRRRYSGSK 186

  Fly   200 SDSNL 204
            |.:.|
Zfish   187 SMAKL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 62/166 (37%)
P-loop_NTPase 17..173 CDD:304359 62/163 (38%)
rerglbNP_001038581.1 RERG_RasL11_like 5..171 CDD:206713 63/172 (37%)
Ras 5..167 CDD:278499 62/161 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0004892
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.