DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and si:dkeyp-59c12.1

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001037795.1 Gene:si:dkeyp-59c12.1 / 555379 ZFINID:ZDB-GENE-050419-167 Length:210 Species:Danio rerio


Alignment Length:209 Identity:77/209 - (36%)
Similarity:113/209 - (54%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            :..:.|:|..:||||||||||||:|:||||. ..|:.|.|..:|||......|.|.....:|  |
Zfish    10 DANVVVLGTDNVGKSALIVRFLTRRFIGEYG-DIESFYTHNIVVDGREQTLNIWDAPYSQQD--P 71

  Fly    80 NAAEL-----VQWADGLLLVYSITDRKSFNYIRRAKSDLQS--------DTPVQLCANKVDMVHL 131
            :...|     :||||||:|||||.||.|||.:.|....:::        ..|:.:..||.|:.|.
Zfish    72 SFETLLCEKRLQWADGLVLVYSICDRASFNTVSRLVHTIKTTKDFLGFEKMPIVIVGNKRDLHHR 136

  Fly   132 RQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGAR--- 193
            |.|..:||.:||...:|:|.|||||::...|..||:.|...:    |:|:.|:  :.|.|.:   
Zfish   137 RTVLSEEGRLLALSADCQFYEVSAAENYHSVLMVFHGLVDRI----RESRVSV--KKLAGIKGIV 195

  Fly   194 -----PYSRGKSDS 202
                 .::|.::||
Zfish   196 KSMSAVFARRRTDS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 69/170 (41%)
P-loop_NTPase 17..173 CDD:304359 69/168 (41%)
si:dkeyp-59c12.1NP_001037795.1 P-loop_NTPase 12..180 CDD:304359 69/174 (40%)
small_GTPase 13..179 CDD:197466 69/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0004892
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.