DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rasl11a

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017840.2 Gene:rasl11a / 550538 ZFINID:ZDB-GENE-050417-384 Length:253 Species:Danio rerio


Alignment Length:209 Identity:76/209 - (36%)
Similarity:106/209 - (50%) Gaps:44/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDT-CPKAED--- 76
            :||.|:||.:|||:||||||||||:||:|:..|...|..:..:|||.|..::.|| |...:|   
Zfish    37 VKIVVLGASNVGKTALIVRFLTKRFIGDYEANTGALYSRKINLDGEQVSLQVQDTPCVSLQDDAD 101

  Fly    77 -----EYPNAAELVQWADGLLLVYSITDRKS-------FNYIRRAKSDLQSDTPVQLCANKVDMV 129
                 |..|.:  :.||||.:||:||||..|       :.::||...  ..:.||.:..||.|::
Zfish   102 GLYCQEQINRS--IYWADGYVLVFSITDLNSYRTIQPLYQHVRRIHP--SGNIPVIIVGNKSDLL 162

  Fly   130 HLRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGG--- 191
            ..||||..||:.||.:....:.|.||.::.:.|...|..||:||            .|.|||   
Zfish   163 RARQVSDPEGKALADELGGLYFEASARENHESVQAAFLHLCQEV------------SRALGGGNG 215

  Fly   192 ---------ARPYS 196
                     |||.|
Zfish   216 EKRKGGLHLARPKS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 66/172 (38%)
P-loop_NTPase 17..173 CDD:304359 66/171 (39%)
rasl11aNP_001017840.2 RERG_RasL11_like 38..208 CDD:206713 68/185 (37%)
Ras 38..206 CDD:278499 66/171 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..233 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5114
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4596
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5611
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.