DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rerg

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_006237644.1 Gene:Rerg / 502916 RGDID:1562829 Length:199 Species:Rattus norvegicus


Alignment Length:178 Identity:77/178 - (43%)
Similarity:103/178 - (57%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            |:|:|:.|...|||||::|||||||:|.|||...|:.|:|:|.:|.|.|..|||||..: ||...
  Rat     6 EVKLAIFGRAGVGKSAIVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQ-EDTIQ 69

  Fly    80 NAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVHLRQVSRDEG 139
            ....: :|.:|.:|||.||||.||..:...|:.|.     .:..:.|..||.|:.|.||||.:||
  Rat    70 REGHM-RWGEGFVLVYDITDRGSFEDVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEG 133

  Fly   140 EILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLER 187
            |.||.:..|.|.|.||......:.|||.|||:||  .:|:..|....|
  Rat   134 EKLASELACAFYECSACTGEGNITEVFYELCREV--RRRRMVQGKTRR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 72/162 (44%)
P-loop_NTPase 17..173 CDD:304359 71/160 (44%)
RergXP_006237644.1 small_GTPase 6..170 CDD:197466 74/167 (44%)
RERG_RasL11_like 8..169 CDD:206713 73/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50142
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.