DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rit1

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_038958818.1 Gene:Rit1 / 499652 RGDID:1559874 Length:219 Species:Rattus norvegicus


Alignment Length:209 Identity:79/209 - (37%)
Similarity:117/209 - (55%) Gaps:29/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE---- 75
            |.|:.::||..|||||:.::|::.|:..::|...|:.||....:|.||...:||||..:||    
  Rat    21 EYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAM 85

  Fly    76 -DEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQV 134
             |:|..|.|      |.::.||||||:||:.:|..|..:     ..||||.|..||.|:..||||
  Rat    86 RDQYMRAGE------GFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQV 144

  Fly   135 SRDEGEILAKDFECKFSEVSAA--DHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGARP--- 194
            |::||..||::|.|.|.|.|||  .::|   :||:.|.:|:    ||.::.|:..|...|:|   
  Rat   145 SKEEGLSLAREFNCPFFETSAAYRYYID---DVFHALVREI----RKKEKELVLAMEKKAKPKSS 202

  Fly   195 -YSRGKSDSNLPKD 207
             :.|.||.....||
  Rat   203 VWKRLKSPFRRKKD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 67/169 (40%)
P-loop_NTPase 17..173 CDD:304359 66/167 (40%)
Rit1XP_038958818.1 Rit_Rin_Ric 20..191 CDD:206712 71/182 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.