DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rergla

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001002494.1 Gene:rergla / 436767 ZFINID:ZDB-GENE-040718-198 Length:205 Species:Danio rerio


Alignment Length:204 Identity:74/204 - (36%)
Similarity:114/204 - (55%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDE 77
            :.::|:||:|:..||||||||||||:|:||||...:|..|:....:|...:..|:.|.|.:..|.
Zfish     1 MNDIKVAVLGSEGVGKSALIVRFLTRRFIGEYASSSECIYRKRMSIDARQLNLELHDPCSQPCDG 65

  Fly    78 YPNAAELVQWADGLLLVYSITDRKSF-------NYIRR-----AKSDLQSDTPVQLCANKVDMVH 130
            .....|.:.||||.::||.|:||.||       :.||.     .|.|  ||:.:.|..||.|:.|
Zfish    66 KSTLNEQIHWADGFVVVYDISDRSSFLTAKAIVHLIRELHLGATKRD--SDSVIFLVGNKQDLCH 128

  Fly   131 LRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV-LASKRKSKQ----------SL 184
            :|:|.|:||:.||.:..|:|.|:|||:|..:|..:|:::.:.. |.||.|.::          .|
Zfish   129 MREVDREEGQKLASESRCQFYELSAAEHYQEVLLMFSKIVRNASLGSKAKERRRRPSGSKSMAKL 193

  Fly   185 LERMLGGAR 193
            :..:.|..|
Zfish   194 INNVFGKRR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 67/170 (39%)
P-loop_NTPase 17..173 CDD:304359 67/167 (40%)
rerglaNP_001002494.1 Small GTPase-like 1..205 74/204 (36%)
RERG_RasL11_like 5..172 CDD:206713 67/168 (40%)
RAS 5..169 CDD:214541 67/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0004892
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.