DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Ras85D

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:183 Identity:57/183 - (31%)
Similarity:91/183 - (49%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE-- 75
            :||.|:.|:||..||||||.::.:...::.|||...|:.|:.:.::|||..|.:||||..:.|  
  Fly     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

  Fly    76 ---DEYPNAAELVQWADGLLLVYSITDRKSF-------NYIRRAKSDLQSDTPVQLCANKVDMVH 130
               |:|....|      |.|||:::...|||       ..|:|.|.  ..:.|:.|..||.|:..
  Fly    66 AMRDQYMRTGE------GFLLVFAVNSAKSFEDIGTYREQIKRVKD--AEEVPMVLVGNKCDLAS 122

  Fly   131 LRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQS 183
            . .|:.::...:||.:...:.|.||...:. |.:.|..|.:|:    ||.|.:
  Fly   123 W-NVNNEQAREVAKQYGIPYIETSAKTRMG-VDDAFYTLVREI----RKDKDN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 53/170 (31%)
P-loop_NTPase 17..173 CDD:304359 51/167 (31%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 53/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.